Char Sheet
very-like-a-whaleluxury-real-obesethe pictures wwwmechanismsmapdaddysmilkmaiden69
Webcam Model (ezabel-) is live.Free join now!
LIVE
Ena - Concept Sheet Update (Casual and Post-Trespasser)So the year later I had a very insistent thou
Ena - Concept Sheet Update (Casual and Post-Trespasser)So the year later I had a very insistent thou
New Character Sheet: Kenta the Eastern Dragon
New Character Sheet: Kenta the Eastern Dragon
BNHA OC Reference Sheet – Kikumi Rui (U.A version)The theme for Rui design here is the ✧arroga
BNHA OC Reference Sheet – Kikumi Rui (U.A version)The theme for Rui design here is the ✧arroga
A boy from Slavonija joins the party!Is he Šilo from “Družba Pere Kvržice”? Is he
A boy from Slavonija joins the party!Is he Šilo from “Družba Pere Kvržice”? Is he
If you follow my Instagram endeavours, you may notice I’d been playing around with the Croatia
If you follow my Instagram endeavours, you may notice I’d been playing around with the Croatia
Kronos motif, 2017Acrylics on paper mounted on a larger sheet, 23 x 17 cm
Kronos motif, 2017Acrylics on paper mounted on a larger sheet, 23 x 17 cm
a simple ref sheet for one of my maple charas
a simple ref sheet for one of my maple charas
heyhelloitsk: I made an expression sheet! Well tried to- You can send character requests of these (p
heyhelloitsk: I made an expression sheet! Well tried to- You can send character requests of these (p
Designed a pokemon oc for animation studies and style experiments
Designed a pokemon oc for animation studies and style experiments
my sweet farmer girl, toni 
my sweet farmer girl, toni 
 #Inktober Day 6 - “Husky”!belle is the brightest, most eye-catching butterfly in t
 #Inktober Day 6 - “Husky”!belle is the brightest, most eye-catching butterfly in t
expression sheet of pluuey’s character orion! he’s such a vibrant and cute characte
expression sheet of pluuey’s character orion! he’s such a vibrant and cute characte
skeleion: Invader Zim: Gir season 1 official Character Model sheet.
skeleion: Invader Zim: Gir season 1 official Character Model sheet.
Hey so, I recreated the character sheet from the Cyberpunk 2077 gameplay video. It’s got layer
Hey so, I recreated the character sheet from the Cyberpunk 2077 gameplay video. It’s got layer
Lil scar reference sheet for Hravanis :)
Lil scar reference sheet for Hravanis :)
Tibernico - Ref Sheet commission for SoundtehBugle on DeviantArt of their character Tibernico
Tibernico - Ref Sheet commission for SoundtehBugle on DeviantArt of their character Tibernico
tempural: Full color character sheet of my spider gorlz: Harriet, Piper, and thotty milve Norma.&nb
tempural: Full color character sheet of my spider gorlz: Harriet, Piper, and thotty milve Norma.&nb
Two versions of my OC Ecrea. This is the base for a design sheet on which I can invent costumes and
Two versions of my OC Ecrea. This is the base for a design sheet on which I can invent costumes and
Character sheet of my Zandalari: Nak'Zeem
Character sheet of my Zandalari: Nak'Zeem
Reference sheet for my Capstone! Project is called “Wishful Thinkin’” 
Reference sheet for my Capstone! Project is called “Wishful Thinkin’” 
Character Expression Sheet.First design.Views.
Character Expression Sheet.First design.Views.
Character design sheet from my projects class.First design
Character design sheet from my projects class.First design
Character Sheet Commission for a user on twitter!Commission info!
Character Sheet Commission for a user on twitter!Commission info!
mageliberation: Hey so, I recreated the character sheet from the Cyberpunk 2077 gameplay video. It&r
mageliberation: Hey so, I recreated the character sheet from the Cyberpunk 2077 gameplay video. It&r
Prev PageNext Page