Christmas Cute

---

blogginglifegordon ramseykhgraphicsfilthymittspathogems

---

LIVE

cuteness–overload:‘Twas the afternoon of Christmas after we opened our stuff. Duncan got settled in

Friend made me a Mad Max Fury Road Milking Mother Pop Vinyl for christmas.How cute is she!

Merry Christmas!loving my new sweater so cozy ☺️

Hope you had a merry Christmas!Galina Dubenenko

Cookies and Milk (via Liz Carter Photography)

palaceofposey:Merry Christmas and Happy Holidays!Have some WTNV holiday sweaters!

thesilverpaws:Ghaaa! The cats keep posing and looking cute with the Christmas decoration, I have no

kelheor-art:The cutest Christmas Mercy sends you lots of love this cold winter! And if you like my a

cute-cosplay-girl:Is it already christmas?! gumiho.arts and Mikomi Hokina. The Reverse 2Bunnies. hos

Merry Bearded Christmas

gemsicle:another merry christmas from 221B :)

cuteskitty:I wanted to finish these silly things on christmas but I was busy with my family. Anyway

Piercing candy cane mug is too cute! Only in Starbucks Japan.

Elves gonna partyDescription:  A cute Christmas elf is partying down.

littlechmura:Christmas Fireworks created for @dhr-advent  Happy Holidays! 

Christmas Came Early

Just because.

mydiaperlife: Merry Christmas Cute Christmas outfit

mydiaperlife: Merry Christmas Cute Christmas outfit

Juniper

thoughtsofasubgirl:quiet-dominant:The perfect Christmas…Cute!Denial December You are on no touch tod

Hope every bunny is excited for Christmas as Protein is!#xmas #holiday #bunniesoftheworld #bunniesta

(via Heidi Bollich)

Tell your pets happy holidays from me! (PS; Don’t leave your noodle puppy in the cold. No nood

Prev PageNext Page