Fab

---

hyde ballcurioosartistace austinaimmmhmarkedpatcheswindyteacups

---

LIVE

mzminola:For the dream-sequence portion of his The Doors solo (Hello) Finn Hudson gets Cheerios as d

faberrytastic:babiegyrle:losrachetss:kingmuthaphuckinbasquiat:thaunderground:sizvideos:VideoI’ve nev

shishitsunari:Le fabuleux destin de Marinette Dupain. I don’t know why.I got the idea from this scre

history-of-fashion:1724 Nicolas de Largillière - Portrait of Mariana Victoria of SpainThat fabric lo

netflixdefenders:therealkrystenritter Killing 3 minutes and being as fabulous as I possibly can. Sla

kindaconfusedchild:fab-bladesmith:Raven FolderHigh Carbon steel blade, hand-carved ebonized oak hand

met-costume:Ball gown, Metropolitan Museum of Art: Costume InstitutePurchase, Irene Lewisohn and Ali

did-you-kno:mymodernmet:Real Life Objects Used as Playful Ingredients for Fabulous Fashion Illustrat

tastefullyoffensive:She knows she’s fabulous. (via kerbiegibbs)

When I’m too broke to go out drinking.

TEXAS MUTUAL AID: Hey guys! If anyone is able to donate (even a dollar is fabulous), please Venmo @/

masoassai:De te fabula narratur, che poi è gpoy ma in latino è piú ganzoEccome, è proprio tosto.

Jørgen Kastholm & Preben Fabricius, executive desk and Tulip chair, 1965. Made by Kill Internati

Portrait of Leonora Baroni (1611-1670) by Fabio Della Cornia (1600-1643), possibly from 1640s

another-confused-ace:Let’s talk about the fabulous aromantics out there

rosy-secrets:☆ More fab posts here ☆

Skeleton   -   Jan FabreBelgian, b. 1958-Museum Beelden aan Zee , The Haghe

dailyemwatson:I want to feel fabulous and comfortable and sexy and strong and beautiful. And if it’s

fabrayandersons-deactivated2014:“I wouldn’t flatter myself and say that I’m on her level. She’

Old South Meeting House, Boston, 1870s.MS Am 2089Inspired by the New York Public Library’s fab

komaedamnit:Armin’s FABULOUS hair

gifsboom:DIY Project : Make a BBQ in a trunk (Swedish Torch method) [video][La Fabrique DIY]I love t

If one simply must sit through a flag day ceremony, I suggest one do it in fabulous vintage pin-up s

fabbgar:@aleinicop ❤❤❤ teamowhoaaa 20k notes on this repost lol!

Prev PageNext Page