Fl Mega
wingfieldparkg3artboldlyangrysharkvivafilipinasikikizkardes
Webcam Model (_Dime_) is live.Free join now!
LIVE
-jenjam:Make Me Choose: Ginoza or Kagari Requested by kougamih
-jenjam:Make Me Choose: Ginoza or Kagari Requested by kougamih
meganwhalenturner:I am sorry to make you guys wait, but I figure you’re all used to that by now. Wha
meganwhalenturner:I am sorry to make you guys wait, but I figure you’re all used to that by now. Wha
sweetest-honeybee:My first attempt at drawing the pearls fusion! It’s not spot on but this was my fi
sweetest-honeybee:My first attempt at drawing the pearls fusion! It’s not spot on but this was my fi
tinysaurus-rex:labrownrecluse:kelpforestdweller:meganecon:??????they told us about this in my intro
tinysaurus-rex:labrownrecluse:kelpforestdweller:meganecon:??????they told us about this in my intro
doomhope:meganluddyillustration:Appalachian Elegy - bell hooks[image description: A drawing in black
doomhope:meganluddyillustration:Appalachian Elegy - bell hooks[image description: A drawing in black
teamfox:Megan Fox out and about on Sunday (August 19) in Los Angeles.
teamfox:Megan Fox out and about on Sunday (August 19) in Los Angeles.
ledger-heath:Megan Fox as Jennifer Check in Jennifer’s Body (2009)
ledger-heath:Megan Fox as Jennifer Check in Jennifer’s Body (2009)
submachineguns:Kaneki isn’t that soft, but you don’t plan to just abandon him, do you? I’ll go, afte
submachineguns:Kaneki isn’t that soft, but you don’t plan to just abandon him, do you? I’ll go, afte
megaloveuuuuuu:I want to be your boipussy trainer baby
megaloveuuuuuu:I want to be your boipussy trainer baby
meganemausu:Big ol’ NIght of the Weremutt 2 Sketch Sequence for @the-entire-furry-fandom !!cream fil
meganemausu:Big ol’ NIght of the Weremutt 2 Sketch Sequence for @the-entire-furry-fandom !!cream fil
picsofmegatron:Megatron Origin - Issue 3
picsofmegatron:Megatron Origin - Issue 3
iwanttosingabouttragedy:thefingerfuckingfemalefury:loki-of-sassgaard:kayathedragon:aganami:disneyyan
iwanttosingabouttragedy:thefingerfuckingfemalefury:loki-of-sassgaard:kayathedragon:aganami:disneyyan
noctissmash:megablaziken:okay but did it need lightningher name is ‘storm’ not ‘light showers with a
noctissmash:megablaziken:okay but did it need lightningher name is ‘storm’ not ‘light showers with a
bbqfish:seventypercentethanol:god of mischief.Wow, I followed your arts from Megami Tensei to Basara
bbqfish:seventypercentethanol:god of mischief.Wow, I followed your arts from Megami Tensei to Basara
missingdesigns:Minion: Megamind (2010)
missingdesigns:Minion: Megamind (2010)
meganmonroes:Jayne Mansfield in 1957.
meganmonroes:Jayne Mansfield in 1957.
pokemon-global-academy:draycen guess who didn’t get a mega evolution? draycen  guess who still don&r
pokemon-global-academy:draycen guess who didn’t get a mega evolution? draycen  guess who still don&r
meganmayday:the best part of being an adult is watching your friends also be adults
meganmayday:the best part of being an adult is watching your friends also be adults
megans-fox:“Who you gonna call?”Ghostbusters (2016) dir. Paul Feig
megans-fox:“Who you gonna call?”Ghostbusters (2016) dir. Paul Feig
Model: @megan.milanNecklace: @voafinejewellery  Outfit: @ohpolly
Model: @megan.milanNecklace: @voafinejewellery  Outfit: @ohpolly
adamdouglasdriver:Move-on dot org, Needy! It’s over. Life’s life too short to be moping around about
adamdouglasdriver:Move-on dot org, Needy! It’s over. Life’s life too short to be moping around about
megagirlthetoaster:whenhellfreezesoverr:aredvineaday:The Starkid Hallows:The Elder VineThe Resurrect
megagirlthetoaster:whenhellfreezesoverr:aredvineaday:The Starkid Hallows:The Elder VineThe Resurrect
glitzbot:various colored sketches from twitter!
glitzbot:various colored sketches from twitter!
springtales:i thought of this and went into a frenzy and drew it in 2 hours
springtales:i thought of this and went into a frenzy and drew it in 2 hours
Prev PageNext Page