Gallery/gallery/eatyourveggies
meenageteetantmeetleteetlemathewsavnfythoward pakterraspark bootssamiaklimos
My food always looks like a mess but it’s so f’n good and my brain wanted more than I could eat so y
My food always looks like a mess but it’s so f’n good and my brain wanted more than I could eat so y
Some health”ier” eats Baked mac & cheez w/ @sfoglini pasta w/ @followyourheart @violife_foods @
Some health”ier” eats Baked mac & cheez w/ @sfoglini pasta w/ @followyourheart @violife_foods @
Baked buckwheat with cabbage, tofu, beet&sunflower seed salad and some green beens!
Baked buckwheat with cabbage, tofu, beet&sunflower seed salad and some green beens!
Spicy sriracha pasta with cauliflower, beans, kale and onion
Spicy sriracha pasta with cauliflower, beans, kale and onion
Last night’s “oh crap, I better use these veggies” meal. I had some cauliflower and green pepper tha
Last night’s “oh crap, I better use these veggies” meal. I had some cauliflower and green pepper tha
Margharita inspired portobello pizza and roasted asparagus. #cooking #lowcarb #vegetarian #meatfree
Margharita inspired portobello pizza and roasted asparagus. #cooking #lowcarb #vegetarian #meatfree
Grilled barbecue tofu and roasted asparagus. So, so good. #cooking #vegan #vegetarian #meatfree #low
Grilled barbecue tofu and roasted asparagus. So, so good. #cooking #vegan #vegetarian #meatfree #low
Big ole salad with some delicious tofu. We have been eating a lot of salads, and I am here for it. #
Big ole salad with some delicious tofu. We have been eating a lot of salads, and I am here for it. #
Portobello with roasted Brussels sprouts! #cooking #dinner #vegan #vegetarian #meatfree #fitmom #eat
Portobello with roasted Brussels sprouts! #cooking #dinner #vegan #vegetarian #meatfree #fitmom #eat
Portobello mushrooms, with roasted, balsamic turnips and a fresh arugula salad topped with truffle o
Portobello mushrooms, with roasted, balsamic turnips and a fresh arugula salad topped with truffle o
Grilled Chile tofu and asparagus and red bell pepper .. plus fresh avocado and cilantro. #cooking #m
Grilled Chile tofu and asparagus and red bell pepper .. plus fresh avocado and cilantro. #cooking #m
Stir fry with vege pork by @morningstarfarms !! Yum. #cooking #dinner #eatyourveggies #vegetarian #m
Stir fry with vege pork by @morningstarfarms !! Yum. #cooking #dinner #eatyourveggies #vegetarian #m
Buffalo chik’n sandwiches using @gardein chik’n patties upped with my own buffalo sauce, @followyour
Buffalo chik’n sandwiches using @gardein chik’n patties upped with my own buffalo sauce, @followyour
Awwww yesssshhh Homemade pulled “pork” sandwiches. I used jackfruit & hearts of palm for the me
Awwww yesssshhh Homemade pulled “pork” sandwiches. I used jackfruit & hearts of palm for the me
One day I’ll be better at taking food pictures Sloppy joe spaghetti squash topped with an olive &am
One day I’ll be better at taking food pictures Sloppy joe spaghetti squash topped with an olive &am
Made some bomb soup babies! Sweet potato and sausage soup with spinach, shitakes, and quinoa pilaf.
Made some bomb soup babies! Sweet potato and sausage soup with spinach, shitakes, and quinoa pilaf.
Some health”ier” eats Baked mac & cheez w/ @sfoglini pasta w/ @followyourheart
Some health”ier” eats Baked mac & cheez w/ @sfoglini pasta w/ @followyourheart
Finally set and filled these three beds that I built last year. Hand tilled up the grass and weeds,
Finally set and filled these three beds that I built last year. Hand tilled up the grass and weeds,
Last night’s “oh crap, I better use these veggies” meal. I had some cauliflower an
Last night’s “oh crap, I better use these veggies” meal. I had some cauliflower an
Big ole salad with some delicious tofu. We have been eating a lot of salads, and I am here for it. #
Big ole salad with some delicious tofu. We have been eating a lot of salads, and I am here for it. #
Taco-ish.. basically grab a bunch of veggies and a protein and throw them together in a wrap. One of
Taco-ish.. basically grab a bunch of veggies and a protein and throw them together in a wrap. One of
Portobello with roasted Brussels sprouts! #cooking #dinner #vegan #vegetarian #meatfree #fitmom #eat
Portobello with roasted Brussels sprouts! #cooking #dinner #vegan #vegetarian #meatfree #fitmom #eat
Grilled barbecue tofu and roasted asparagus. So, so good. #cooking #vegan #vegetarian #meatfree #low
Grilled barbecue tofu and roasted asparagus. So, so good. #cooking #vegan #vegetarian #meatfree #low
Pretty stoked on this new “Garden Bouquet” addition to my botanical print series
Pretty stoked on this new “Garden Bouquet” addition to my botanical print series
Prev PageNext Page