Gallery/gallery/forgedinfire

---

huskerdust fanartvirtualshowgreysweatpantskidactivitiespaul sandby

---

Bladeshow Build Blade Auction! Here is the finished knife I (we) made at @blade_show this year all f

I had a small bit of silicon bronze (from @onlinemetals ) leftover from another project, so I decide

I was recently asked to forge a putter. This is waaaaay out of my wheelhouse. I messed up 3 putters

Some still shots of the celtic war knife build. It’s a low layer pattern with a forged ring po

Getting this globular gripped ringed pommel war knife dressed up a bit. Outfitted with some geometri

Forged a quick little #kiridashi in the shop today with @stilken103 We shot some video that may end

I’ve recently had a lot of requests for that Serbian chefs knife that’s going around. He

More shots of these copper arm rings - requested by @daybreak_firearts . These rings were forged fro

A couple viking inspired arm rings in copper. Hand forged with @hilltopforge hammers and all the det

Progression sequence of me forging the low layer block of @bob_rankin_custom_knives damascus out int

Forging progression of a chefs knife. I like to say, “It looks like shit until it doesn’

On deck: testing a new pattern for a little something with @waterjetknives (follow them to see when

Finished up this “work along with me” knife session today out at @bavarianblacksmithexp

Throwing sparks all day with the crew at @bavarianblacksmithexp (the shop at @riverplaceshops in @fr

This choppah/chef is waxed and ready for action! . Steel: 1095/15N20 clad over 80CRV2 core from @nj_

Here is a still shot for thise that just want to stare at her… I am actually digging that dra

Available! - this beautiful snakeskin juma handled knife could be yours. It’s got a surprising

It was an incredibly cold day, or maybe we should have put the long underwear on, but we managed to

Full day class with an inspiring man. He’s 68 and picking up a new hobby. I ran him through th

I finished up this chefs knife for Josephine. I experimented with a hollow grind on the right side o

The glow of the forge is an intoxicating thing. The warmth keeps bringing me back for more. With a l

I really enjoyed making this lovely chopper inspired knife. Sometimes the quick scribblings of soaps

I had a small bit of silicon bronze (from @onlinemetals ) leftover from another project, so I decide

Here is a still shot for thise that just want to stare at her… I am actually digging that

Prev PageNext Page