Lgbt Book

---

rkper seTeen cheerleaderfrenchchickenravenandthepeachwefancy

---

LIVE

Craving Stardust (2020) by Morgan tollCraving Stardust is a poetry book that was put together from e

Husband & Husband #95 “My husband is NOT pregnant”Buy the book here: Husban

Husband & Husband #92 “My husband is sneaky”Book #2 of H&H is avail

Sometimes a vampire falls in love with his human best friend. Sometimes they go to a karaoke bar and

The Southern Gothic UniverseThe ongoing misadventures of a vampire, a monster hunter, and their unli

Pages I Never Wrote: An LGBT University Romance | OUT JUNE 23rdPreorder now on:Amazon.com (US)Amazon

her name in the sky headersplease:like/reblog if you save;or credit @catraprice on twitter.

BIG BOOKISH ANNOUNCEMENT!Tomorrow at midnight (UK time)Follow at @booksbymarco on Instagram for more

Spoilers for a 118 year old book

bisexual-community: [Image: A mother reading a picture book to her child. The image is done in a tr

terriblymightythings: books I’ve read in 2021: in other lands by sarah rees brennan Cousin Gre

aclaywrites: kittenanarchy: galesofnovember: I bought this book on a whim because I saw it on tumblr

Dark academia Brownitian moodboard!

“Her name’s Nellie. She’s really old but I love her" #IW

Me reading Lord of the White Hell in 2011: I hope Javier and Kiram find happiness.Me reading Master

My piece for @rainbowcrate’s April book box.Ashley Woodfolk’s Nothing Burns As Bright As

Finally finished Sabran and Eadaz too. The Priory of the Orange Tree by @sshannonauthor

My piece for @rainbowcrate’s February’s book box.Rosiee Thor’s Fire Becomes Her.

My piece for @rainbowcrate’s January book box.A.L. Graziadei’s Icebreaker.

Misery Kite warm-up sketch.

Commission for @theonesarcasticchick of Mayan from The Tarot Sequence and the magical cat they headc

Commission for @re-med-y of Finn and Roark from Prince of Air and Darkness by M.A Grant.

My piece for @rainbowcrate’s December book box.Alicia Jasinska’s The Midnight Girls

My piece for @rainbowcrate’s November book box.Freya Marske’s ( @fahye ) A Mar

Prev PageNext Page