kousseii:oyatetsurou:hvnamiya:kandavu:gangstakaashi:simpleinfinitychild:tobeflyhaikyuu:chuuyazai:pin
kousseii:oyatetsurou:hvnamiya:kandavu:gangstakaashi:simpleinfinitychild:tobeflyhaikyuu:chuuyazai:pinktatertots99:nanbahcs:pinktatertots99:cock-matsu:late-night-snac:kamblam:swedish-burrito:kamblam:swedish-burrito:weirdodoodles:chocolatespices:lunaklow:ravenonthetardis:mypoorfaves:fluffyllamas22:itisasign:amycampbell00:cocoa-bun:cocoa-bun: ٩(๑❛ᴗ❛๑)۶♥It warms my heart that people are tagging each other in this post?? Oh my word!! Keep up the positivity!!@itisasign ;DI am tagging all these people hold up:@amycampbell00 (fite me on this you wonderful friend you ♥♥)@smolsickficwriter (if you dare argue I’ll send my scariest OC after you —♥ baemom)@fluffyllamas22 (I barely know you but your fics are perfection so you are too!)@dont-look-so-good (also you and I swear to the lord do not argue ily ♥ also I love all your OCs)@jojowritesstuff (also you because I love reading your random posts and fics ♥)@dontfeelsogood (also you, know that you are loved by this random user ♥)@usethetriforce13 (don’t think I don’t notice you’re awesome taste in anime ♥)@hotarubi-e (also you have great taste, are a wonderful writer and person ♥)@daehdream (I know we’ve never talked but I like you stuff all the time because B.A.P are perfect and Jongup is life and your taste in music is perfection so ♥ don’t fite me)Also @every single person who follows me and whom I follow ♥ I love you all!@itisasign omg I flipping love you. This is so sweet, thank you So I’m gonna tag some people @toosicktoocare@taylor-tut@mypoorfaves@senberet@kotyonoksnz@itisasign You guys are all fabulous and I love you dearly (even if we don’t actually talk on a regular basis) Ahhh I forgot to reblog this earlier! @fluffyllamas22 You are so sweet! Gotta spread the love!The following people are perfect and I love them:(This is gonna be a long list) Keep reading@lunaklow@frances-janvierYou too:)@shosmol @cloudydoodle @chocolatespices @extra-ugly-d0gg0@ratmat @grimkipp @tornqdo@fangirl323 @unforgettable-mistake @br00kie-draws@kamblam pff ilySCREAMS I FUCKING LOVE YOU MORE OMF CRIESnO I LOVE U MORE DJHDHMOST I WIN HHHHHHAH@cock-matsuHhhh@late-night-snac@telephoneghosts@preciousbarashark@snubbin@nightmaresawakening@nightmaressleeping@nightdrawer1234@hetaliamatsu@akimonochan@a lot of pwo pl e that message me that I haven’t memorized your url yet I’m sorry I’m on mobile@sugarpinkbloodtea @sugar–trash @proxypunch @nanbahcs @nbqigongmaster @mostlikelytofangirl @someoneyoumeet @minty-zombie @epicsmiley13 @fizzytears @filamints @katskii @wukongs-strife @a-lesnikova @pizzahutchan124 @k-t-roze @lostnova @elanc5 @thatoldeblackmagic @thenardier @fangirl20 @cutie-tabootie @ianwaszelewski @the-red-rose-dragon @ayalaatreides@mlgshipping @chocolateclockwise @pinktatertots99 @risotto-relatable @territorialbitch@enigmaunseen @starthebutterfly @blogquantumreality @bringmethestarlight @spacefrug @spacecatbiologist @skeletortilla @immortal-domain @vanille-mente @akimonochan @the-socially-awkward-penguin @sushimuffinbuns @raewolf313 @you-cant-tell-me-what-to-draw @optimistic-alpaca @chuuyazaiand everyone else who sees this!THANK YOU SO MUCH LOVE@eien-misui-ni-goodbye @kingshadows1001 @freezingdreamer @nekhasfallenon @waveringshadow @kanekkis @the-strange-fish @whos-gonna-love-you @the-red-rose-dragon @chuuchuuyaa @miyuusawa @shirooyashaa @aikashipseverything @tobeflyhaikyuu @sadplisetsky and everyone else reading this!!@stay-alive-iwaoi @kagewho @chuuyazai @simpleinfinitychild @dumbass-kagehina @meiyanaalexia @spicyboikeith @megopoly @theresbeenamistake @kryste-harte @sasukesdad @fandom-traaash @hinatas-smile @binktop @killer-serve @sandvipers @thegoldenonyx @ichivamp @fruitsnake @chuuchuuyaa @haikyuu-phandom @tendous-satoris @nxctemhaze @bakayama-kun @terorou @bungoustraydogs-hcs @mrs-dragneel-bitches @kozumesapplepi @kenmadorable @akaashi-lovely @lnstead @catsandlollipops @fascinatedfox @trashyhina @notime-left @hello-pastel-dreamsYou’re such a sweet heart <3 thank youuu these people are lovely as well @catsandlollipops @mybabystriders @gangstakaashi @heckks @bunnyisfab @slashbringingtrasher @nxctemhaze @faesassomg this made my day!!! thank you you’re so lovely!!!! here are some people who are amazing too @crazyfrankierospuppy, @suga–wara, @kandavu, @requiem-of-a-fool, @ayumiminato, @i-preen-for-oikawa, @meiyanaalexia, @bokutoya, @dattebayousuratonkachiaaaa thank you so much!!! here are some sunshines @hvnamiya @tsukiko-ciah @tsukii @hevlasxa @atsushisnakajima @kkookiedough @josenjisdhfhgasdf thank you so much, yana ily <3 here’re some really cool people @sakkaguchi @kagamiz @oyatetsurou @viktcrs @gin-toki @hirakum @atsushisnakajima @todorokiih @nozumuaaaa thank you so much @hvnamiya! right back at you ♡ here’s some awesome people: @kiirishiima, @kvroo, @itoorukimasu, @kousseii, @ayukii, @unhappyghoul, @matsvhanas, @virosodi, @s-hoyo, @sarukui, @hiwazumi, @tsukii, @kyuubiko, @oik-awasyou are so nice???? tysm!! @oyatetsurouand heyyy @brilliantlydisturbed @resident-tobio-of-english-class @pastel-anime-witch @viiktornikiforovs @y-uuriis @viktuuryy @fascinatedfox @ichibaes @princess-yonas @kagevama @vitjanikiforova -- source link
Tumblr Blog : angelofcrimea-deactivated201811.tumblr.com
#omg!!!!!#thank you!!#long post#tagged in#text
More pics about
periwjnklekousseiioyatetsurouhvnamiyakandavugangstakaashisimpleinfinitychildtobeflyhaikyuuchuuyazaiperksofbeingalunatic-deactivatehotnakedbbwtravelinglight