Authenticcorset

---

sweetspankingvspankingfeelingmichelle-monroeplush ponygoodnotesreckless-harding

---

Hair and makeup not done, but couldn’t help sharing a sneaky peeky ❤️ corset dress by @armando_gabri

Reviewing the Dutch Masters overbust corset by @skeletonsintheclosetcorsetry today!Can I just say ho

Next corset review is now up! This is the Extreme Waist longline with real (public domain) illustrat

Did you catch my review this week on this gorgeous cupped overbust by @madamesher ?This is going to

NEW VIDEO: Today I’m reviewing the Lara Mesh underbust by @glamorouscorset . This one stands out to

NEW VIDEO: Today I’m reviewing the Lara Mesh underbust by @glamorouscorset . This one stands out to

Did you see the review I uploaded on Friday? This is the Jade longline corset by @glamorouscorset ⏳

Moving sale! Next week I’m moving to a smaller space (with higher rent) and I need to clear out part

I am the sparkliest dragon. #31daysofhalloween #halloween #dragon #madebyme #corsetier #authenticcor

Handwork… Sneak peak of embroidery on a client’s corset. #wip #MadeByHumanHands #Exquis

From back in the day: Divinora in our #overbustcorset in a fabulous photo by @hollywestphotography

Last but not least from my underwater shoot inspired by The Last Unicorn. Photograhper: @brettsphoto

Short but sweet day trip up north, missing it already. #faire #renfaire #renaissancefaire #renaissan

Make merry for the gods of Valhalla! Exploring the Valhalla Renaissance Faire with @27crossroads tod

underwater shoot inspired by The Last Unicorn. Photograhper: @brettsphoto MUA: Jessica Vaughn Wardr

#throwbackthursday to this strapy custom order for a client. Nicknamed the poison frog, it was commi

Lady Amalthea among the waves, inspired by The Last Unicorn Photograhper: @brettsphoto MUA: Jessica

Finished natural form bustle ✂️ I love the serendipitous show through of my dress back #bustle #sewi

Today I’m heading back to the #symingtoncollection for another study session along with @k

We’re serious about creating #luxurycorsetry but don’t take ourselves too seriou

My dear client and friend Emily popped into #VanyanisHQ today and I couldn’t resist puttin

Handwork… Sneak peak of embroidery on a client’s corset. #wip #MadeByHumanHands

From back in the day: Divinora in our #overbustcorset in a fabulous photo by @hollywestphotography

Did you attend @midsummerscream In Long Beach? I finally got spread out that pile of 2001 DIY flyers

Prev PageNext Page