Gallery/bulking Season

---

gampanqpiawtweekernappyleedsamputationthevirginstrokes

---

hairybodybuilders:James Hollingshead

domesticdad:6 weeks difference. I’ve been bulking and trying to get rid of that seasonal affec

… I just wanna feast Him on homemade treats. #homemade #chocolate #protein #pancakes #ca

Another Friday, another gym selfie. The spring bulking season is going well, first time in years I&a

moldableclay:coachs-kit-bag:It’s bulking season, boy Bulking SeasonIt was his own fault, reall

hunkydudes:Updates from my crush lee_jangmin

Early Christmas present to myself. Gave up bulking season and kept up my summer diet/cardio. Actuall

ddansuneforet:Post-Chipotle, donuts, and milk. Starting off bulking season pretty well!

flexcomics: Bulking Season by FlexComics.com

Prev PageNext Page