Gallery/gallery/gallery/cr Painting
guardmesherlock-rowangrannies-spiritsara-scrivefalsemrsacapturearizona
Mona Lisa Is Alone, but Still SmilingWith the Louvre closed because of the pandemic, museum official
Mona Lisa Is Alone, but Still SmilingWith the Louvre closed because of the pandemic, museum official
Vladimir Veličković
Vladimir Veličković
Alex Grey (b. 1953)Ophanic Eyelash ,2007Seraphic Transport Docking on the Third Eye ,2004Fractal Eye
Alex Grey (b. 1953)Ophanic Eyelash ,2007Seraphic Transport Docking on the Third Eye ,2004Fractal Eye
readysteadytrek:Painting is all done!! Lil Enterprise A in a Vulcan salute with a purple/blue nebula
readysteadytrek:Painting is all done!! Lil Enterprise A in a Vulcan salute with a purple/blue nebula
Art by Mark Lovett1. Grace2. Ladybug3. Madelyne in the Park4. Spring in Fall
Art by Mark Lovett1. Grace2. Ladybug3. Madelyne in the Park4. Spring in Fall
L'ami de mon amie (Éric Rohmer, 1987)
L'ami de mon amie (Éric Rohmer, 1987)
Frescoes from a cubiculum in the Villa Arianna at Stabiae, Italy 
Frescoes from a cubiculum in the Villa Arianna at Stabiae, Italy 
Details from a fresco in a triclinium of the Villa Arianna at Stabiae Roman, late 1st Century B.C. o
Details from a fresco in a triclinium of the Villa Arianna at Stabiae Roman, late 1st Century B.C. o
Details of the wall paintings in a cubiculum (bedroom) from the Villa of P. Fannius Synistor at Bosc
Details of the wall paintings in a cubiculum (bedroom) from the Villa of P. Fannius Synistor at Bosc
theancientworld:Fresco wall painting in a cubiculum (bedroom) from the Villa of P. Fannius Synistor
theancientworld:Fresco wall painting in a cubiculum (bedroom) from the Villa of P. Fannius Synistor
Daniel Zender (American, based Brooklyn, NY, USA) - 1: Teeth, 2014  Painting  2: Death Penalty for t
Daniel Zender (American, based Brooklyn, NY, USA) - 1: Teeth, 2014  Painting  2: Death Penalty for t
last painting of 2019. Wishing you all beauty, peace and happiness for 2020. We’re all in this toget
last painting of 2019. Wishing you all beauty, peace and happiness for 2020. We’re all in this toget
my illustrations series: on the road. i draw a pic after my travel. 
my illustrations series: on the road. i draw a pic after my travel. 
humanveil:Portrait de la jeune fille en feu | Portrait of a Lady on Fire (2019) dir. Céline Sciamma.
humanveil:Portrait de la jeune fille en feu | Portrait of a Lady on Fire (2019) dir. Céline Sciamma.
saltwort:I’ve been painting some witch’s hats in anticipation of October and posting them over on tw
saltwort:I’ve been painting some witch’s hats in anticipation of October and posting them over on tw
drew some character portraits for a friend’s story
drew some character portraits for a friend’s story
Minoan clay pyxis (cylindrical vessel with lid), depicting a man in a long robe (possibly a priest)
Minoan clay pyxis (cylindrical vessel with lid), depicting a man in a long robe (possibly a priest)
Mycenaean stirrup jar depicting an octopus. Artist unknown; Late Helladic IIIC (13th cent. BCE). Now
Mycenaean stirrup jar depicting an octopus. Artist unknown; Late Helladic IIIC (13th cent. BCE). Now
Romaine Brooks, Peter, a Young English Girl, 1923-24(Portrait of Gluck, aka Hannah Gluckstein)I&rsqu
Romaine Brooks, Peter, a Young English Girl, 1923-24(Portrait of Gluck, aka Hannah Gluckstein)I&rsqu
Leonor Fini, La Grange Batelièr, 1977
Leonor Fini, La Grange Batelièr, 1977
Smell by Lisk Feng @liskfeng ✨#illustration #painting #smell #liskfeng #instaart #instaartist
Smell by Lisk Feng @liskfeng ✨#illustration #painting #smell #liskfeng #instaart #instaartist
antinferno:“The Dead Christ Supported by an Angel” 1475-1478Antonello da Messina in “Bat
antinferno:“The Dead Christ Supported by an Angel” 1475-1478Antonello da Messina in “Bat
Elizabeth Nourse, Tendresse, 1909
Elizabeth Nourse, Tendresse, 1909
One last group of backgrounds from Scent of Prey. I had originally pitched this sequence as a red fo
One last group of backgrounds from Scent of Prey. I had originally pitched this sequence as a red fo
Prev PageNext Page