Gallery/tw Angst
ihrinmunteanutinypenississycestlavie-itslifewhite fishnetcogito-ergo-disco
thebenrey:post xen angst? nah man. this is how the apology went
thebenrey:post xen angst? nah man. this is how the apology went
seriema:[dimitri voice] dear diary, my teen angst bullshit has a body count.
seriema:[dimitri voice] dear diary, my teen angst bullshit has a body count.
“They found Jimin underneath a bridge” My entry for inktober day 4! Just finished readin
“They found Jimin underneath a bridge” My entry for inktober day 4! Just finished readin
Caught in a lie.IG: badboymintyongi
Caught in a lie.IG: badboymintyongi
Help, I have a disease and it’s called Hoseok-itis…
Help, I have a disease and it’s called Hoseok-itis…
zacksoldiers:✵Shinra Week Day 1: Favorite SOLDIER
zacksoldiers:✵Shinra Week Day 1: Favorite SOLDIER
lyattgifs:“If you care about someone… if you trust someone… if you, might even love someone… you’d t
lyattgifs:“If you care about someone… if you trust someone… if you, might even love someone… you’d t
Tim + Rain + a little bit of angst, from @pezilla ‘s wonderful fic Timothy Stoker’s Guide to Dating 
Tim + Rain + a little bit of angst, from @pezilla ‘s wonderful fic Timothy Stoker’s Guide to Dating 
elledix:avatarsymbolism:Zuko going into an angst coma because he made the right decision. That momen
elledix:avatarsymbolism:Zuko going into an angst coma because he made the right decision. That momen
tigerlilynoh:Every angst fanfic writer ever.
tigerlilynoh:Every angst fanfic writer ever.
Sasha Week(thank you @sashaweek for organizing this!)Day one: Danger (angst, hurt/comfort)[ID: a dig
Sasha Week(thank you @sashaweek for organizing this!)Day one: Danger (angst, hurt/comfort)[ID: a dig
saltybatman:#cowboy son distressed by angst of badass dad#ninja son is tired and vodka aunt continue
saltybatman:#cowboy son distressed by angst of badass dad#ninja son is tired and vodka aunt continue
Then there was the obligatory Rhack angst request. Even the name of the palette suits it
Then there was the obligatory Rhack angst request. Even the name of the palette suits it
shortnime:「MC’s Theory of Happiness」Everyone keep on going about individual character’s angst but le
shortnime:「MC’s Theory of Happiness」Everyone keep on going about individual character’s angst but le
avatarsymbolism:Zuko going into an angst coma because he made the right decision.
avatarsymbolism:Zuko going into an angst coma because he made the right decision.
 Sketches I did for the Banner on @alchemyinitiative
 Sketches I did for the Banner on @alchemyinitiative
Yuji x Reader – Lifesaver(spoiler if you haven’t watched the latest episodes)Plot: Y/N saves Yuji’s
Yuji x Reader – Lifesaver(spoiler if you haven’t watched the latest episodes)Plot: Y/N saves Yuji’s
ssherlock:hayffie week → day five: angst
ssherlock:hayffie week → day five: angst
killamonstar:They met either because of an escaped newt, or the fates determining their course. Xen
killamonstar:They met either because of an escaped newt, or the fates determining their course. Xen
Art for True Hans Soul Rebel, Sequence F1: The Theater of MemoryRead here: https://archiveofourown.o
Art for True Hans Soul Rebel, Sequence F1: The Theater of MemoryRead here: https://archiveofourown.o
Random LEVI gifs: 15/?  
Random LEVI gifs: 15/?  
qhio:Boredom and teenage angst in 80s America.by Sage Sohier.
qhio:Boredom and teenage angst in 80s America.by Sage Sohier.
adiosassholes:that’s why I say this planet’s still a kid. a little kid sick and trembling in the mid
adiosassholes:that’s why I say this planet’s still a kid. a little kid sick and trembling in the mid
day 6 of hanakou week! decided to go a little bit angst today with the prompt fantasy, just a bit of
day 6 of hanakou week! decided to go a little bit angst today with the prompt fantasy, just a bit of
Prev PageNext Page